Lineage for d4uonb_ (4uon B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1547302Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 1547391Protein automated matches [190658] (4 species)
    not a true protein
  7. 1547392Species Aura virus [TaxId:44158] [194195] (4 PDB entries)
  8. 1547398Domain d4uonb_: 4uon B: [260594]
    automated match to d1kxfa_
    complexed with gol

Details for d4uonb_

PDB Entry: 4uon (more details), 1.81 Å

PDB Description: Crystal structure of C-terminal truncated (110-265) Aura virus capsid protease.
PDB Compounds: (B:) capsid protease

SCOPe Domain Sequences for d4uonb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uonb_ b.47.1.3 (B:) automated matches {Aura virus [TaxId: 44158]}
alkfeadrtfavknedgkimgyavamegkvikplhvkgtidhpalaklkftksssydmef
aklptemksdafgyttehpegfynwhhgavqfsggrftiptgaggpgdsgrpildnsgkv
vaivlgganegartalsvvtwnkkgaaiktth

SCOPe Domain Coordinates for d4uonb_:

Click to download the PDB-style file with coordinates for d4uonb_.
(The format of our PDB-style files is described here.)

Timeline for d4uonb_: