Lineage for d4tvya2 (4tvy A:247-337)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240027Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 2240028Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 2240081Family d.224.1.3: SP1160 C-terminal domain-like [143216] (2 proteins)
    automatically mapped to Pfam PF10437
  6. 2240085Protein Two-domain LplA, C-terminal domain [160211] (1 species)
  7. 2240086Species Escherichia coli [TaxId:562] [160212] (5 PDB entries)
    Uniprot P32099 247-337
  8. 2240091Domain d4tvya2: 4tvy A:247-337 [260592]
    Other proteins in same PDB: d4tvya1, d4tvyb1
    automated match to d3a7ra2
    complexed with 37r

Details for d4tvya2

PDB Entry: 4tvy (more details), 2.15 Å

PDB Description: apo resorufin ligase
PDB Compounds: (A:) Lipoate-protein ligase A

SCOPe Domain Sequences for d4tvya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tvya2 d.224.1.3 (A:247-337) Two-domain LplA, C-terminal domain {Escherichia coli [TaxId: 562]}
qapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradm
lqqeceallvdfpeqekelrelsawmagavr

SCOPe Domain Coordinates for d4tvya2:

Click to download the PDB-style file with coordinates for d4tvya2.
(The format of our PDB-style files is described here.)

Timeline for d4tvya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4tvya1