SCOPe 2.05: Domain d4tvya2: 4tvy A:247-337

Lineage for d4tvya2 (4tvy A:247-337)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.224: SufE/NifU [82648] (1 superfamily)
   alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123

4. Superfamily d.224.1: SufE/NifU [82649] (4 families)
   iron-sulfur cluster assembly proteins

5. Family d.224.1.3: SP1160 C-terminal domain-like [143216] (2 proteins)
   automatically mapped to Pfam PF10437

6. Protein Two-domain LplA, C-terminal domain [160211] (1 species)

7. Species Escherichia coli [TaxId:562] [160212] (5 PDB entries)
   Uniprot P32099 247-337

8. Domain d4tvya2: 4tvy A:247-337 [260592]
   Other proteins in same PDB: d4tvya1, d4tvyb1
   automated match to d3a7ra2
   complexed with 37r

Details for d4tvya2

PDB Entry: 4tvy, 2.15 Å

PDB Description: apo resorufin ligase

PDB Compounds: (A:) Lipoate-protein ligase A

SCOPe Domain Sequences for d4tvya2:

Sequence; same for both SEQRES and ATOM records:

>d4tvya2 d.224.1.3 (A:247-337) Two-domain LplA, C-terminal domain {Escherichia coli [TaxId: 562]}
qapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradm
lqqeceallvdfpeqekelrelsawmagavr

Timeline for d4tvya2:

• d4tvya2 first appeared in SCOPe 2.04
  
• d4tvya2 appears in SCOPe 2.06
  
• d4tvya2 appears in the current release, SCOPe 2.08