Lineage for d4tvya1 (4tvy A:1-246)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208884Family d.104.1.3: LplA-like [143642] (6 proteins)
    part of Pfam PF03099
  6. 2208901Protein Two-domain LplA, N-terminal domain [160607] (1 species)
  7. 2208902Species Escherichia coli [TaxId:562] [160608] (5 PDB entries)
    Uniprot P32099 1-246
  8. 2208907Domain d4tvya1: 4tvy A:1-246 [260591]
    Other proteins in same PDB: d4tvya2, d4tvyb2
    automated match to d3a7ra1
    complexed with 37r

Details for d4tvya1

PDB Entry: 4tvy (more details), 2.15 Å

PDB Description: apo resorufin ligase
PDB Compounds: (A:) Lipoate-protein ligase A

SCOPe Domain Sequences for d4tvya1:

Sequence, based on SEQRES records: (download)

>d4tvya1 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]}
stlrllisdsydpwfnlavaecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
ndlvvktvegdrkvsgsayretkdrgahggtlllnadlsrlanylnpdkkklaakgitsv
rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
wewnfg

Sequence, based on observed residues (ATOM records): (download)

>d4tvya1 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]}
stlrllisdsydpwfnlavaecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
ndlvvktvegdrkvsgsayretkdrgahggtlllnadlsrlanylnpdkkklaarvtnlt
ellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqsswewnfg

SCOPe Domain Coordinates for d4tvya1:

Click to download the PDB-style file with coordinates for d4tvya1.
(The format of our PDB-style files is described here.)

Timeline for d4tvya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4tvya2