Lineage for d4tqob_ (4tqo B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066580Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2066581Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (4 protein domains)
  6. 2066619Protein automated matches [190582] (2 species)
    not a true protein
  7. 2066624Species Methylococcus capsulatus [TaxId:243233] [260037] (1 PDB entry)
  8. 2066626Domain d4tqob_: 4tqo B: [260589]
    Other proteins in same PDB: d4tqoi_, d4tqoj_, d4tqok_, d4tqol_, d4tqom_, d4tqon_, d4tqoo_, d4tqop_
    automated match to d2ad7a_
    complexed with ca, pqq

Details for d4tqob_

PDB Entry: 4tqo (more details), 2.57 Å

PDB Description: The crystal structure of methanol dehydrogenase from Methylococcus capsulatus (Bath)
PDB Compounds: (B:) Methanol dehydrogenase protein, large subunit

SCOPe Domain Sequences for d4tqob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tqob_ b.70.1.1 (B:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
nseldrlskddrnwvmqtkdysathfsrlteinshnvknlkvawtlstgtlhghegaplv
vdgimyihtpfpnnvyavdlndtrkmlwqykpkqnpaaravaccdvvnrglayvpagehg
pakiflnqldghivalnaktgeeiwkmensdiamgstltgapfvvkdkvlvgsagaelgv
rgyvtaynikdgkqewrayatgpdedllldkdfnkdnphygqfglglstwegdawkiggg
tnwgwyaydpkldmiyygsgnpapwnetmrpgdnkwtmtiwgrdadtgrakfgyqktphd
ewdyagvnymglseqevdgkltpllthpdrnglvytlnretgalvnafkiddtvnwvkkv
dlktglpirdpeystrmdhnakgicpsamgyhnqgiesydpdkklffmgvnhicmdwepf
mlpyragqffvgatlnmypgpkgmlgqvkamnavtgkmewevpekfavwggtlatagdlv
fygtldgfikardtrtgelkwqfqlpsgvighpityqhngkqyiaiysgvggwpgvglvf
dlkdptaglgavgafrelahytqmggsvfvfsl

SCOPe Domain Coordinates for d4tqob_:

Click to download the PDB-style file with coordinates for d4tqob_.
(The format of our PDB-style files is described here.)

Timeline for d4tqob_: