Lineage for d4tpka_ (4tpk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136259Species Human (Homo sapiens) [TaxId:9606] [188340] (71 PDB entries)
  8. 2136346Domain d4tpka_: 4tpk A: [260588]
    automated match to d1maac_
    complexed with 3f9, edo, gol, nag

Details for d4tpka_

PDB Entry: 4tpk (more details), 2.7 Å

PDB Description: Human butyrylcholinesterase in complex with N-((1-(2,3-dihydro-1H-inden-2-yl)piperidin-3-yl)methyl)-N-(2-methoxyethyl)-2-naphthamide
PDB Compounds: (A:) cholinesterase

SCOPe Domain Sequences for d4tpka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tpka_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkya
nsccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgt
sslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqkni
aafggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnr
tlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdm
pdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvs
efgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfe
hrssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpne
tqnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkvl

SCOPe Domain Coordinates for d4tpka_:

Click to download the PDB-style file with coordinates for d4tpka_.
(The format of our PDB-style files is described here.)

Timeline for d4tpka_: