SCOPe 2.04: Domain d4rdqf2: 4rdq F:108-212

Lineage for d4rdqf2 (4rdq F:108-212)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d4rdqf2: 4rdq F:108-212 [260587]
   Other proteins in same PDB: d4rdqf1, d4rdqh1
   automated match to d2fd6l2
   complexed with c6n, ca, cl, gol, k

Details for d4rdqf2

PDB Entry: 4rdq, 2.85 Å

PDB Description: calcium-activated chloride channel bestrophin-1, from chicken, in complex with fab antibody fragments, chloride and calcium

PDB Compounds: (F:) Fab antibody fragment, light chain

SCOPe Domain Sequences for d4rdqf2:

Sequence; same for both SEQRES and ATOM records:

>d4rdqf2 b.1.1.2 (F:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4rdqf2:

• d4rdqf2 is new in SCOPe 2.04-stable
  
• d4rdqf2 appears in SCOPe 2.05
  
• d4rdqf2 appears in the current release, SCOPe 2.08