![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d4rdqh1: 4rdq H:1-107 [260584] Other proteins in same PDB: d4rdqf2, d4rdqg1, d4rdqg2, d4rdqh2, d4rdqi1, d4rdqi2, d4rdqj2, d4rdqk1, d4rdqk2, d4rdql2, d4rdqm1, d4rdqm2, d4rdqn2, d4rdqo1, d4rdqo2 automated match to d2fd6l1 complexed with c6n, ca, cl, gol, k |
PDB Entry: 4rdq (more details), 2.85 Å
SCOPe Domain Sequences for d4rdqh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rdqh1 b.1.1.0 (H:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} diqmtqspaslsasvgetvtitcraseniysyltwyqqkqgkspqllvynaktltegvps rfsgsgsgtqfslkinslqpedfggyfcqhhygtpptfgggtklevk
Timeline for d4rdqh1: