SCOPe 2.05: Domain d4r4be2: 4r4b E:107-211

Lineage for d4r4be2 (4r4b E:107-211)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (14 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
Domain d4r4be2: 4r4b E:107-211 [260583]
Other proteins in same PDB: d4r4ba1, d4r4bc1, d4r4be1, d4r4bl1
automated match to d2fjha2
complexed with nag, so4

Details for d4r4be2

PDB Entry: 4r4b (more details), 2.2 Å

PDB Description: crystal structure of the anti-hiv-1 antibody 2.2c

PDB Compounds: (E:) fab 2.2c light chain

SCOPe Domain Sequences for d4r4be2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r4be2 b.1.1.2 (E:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d4r4be2:

Click to download the PDB-style file with coordinates for d4r4be2.
(The format of our PDB-style files is described here.)

Timeline for d4r4be2: