Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (8 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (209 PDB entries) Uniprot P62988 identical sequence in many other species |
Domain d4rf1b_: 4rf1 B: [260580] Other proteins in same PDB: d4rf1a1, d4rf1a2 automated match to d1xd3b_ complexed with 3cn, pgo, zn |
PDB Entry: 4rf1 (more details), 2.15 Å
SCOPe Domain Sequences for d4rf1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rf1b_ d.15.1.1 (B:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrg
Timeline for d4rf1b_: