SCOPe 2.06: Domain d1pytd_: 1pyt D:

Lineage for d1pytd_ (1pyt D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (60 PDB entries)
   Uniprot P00766

8. Domain d1pytd_: 1pyt D: [26058]
   Other proteins in same PDB: d1pyta_, d1pytb_, d1pytc_
   chymotrypsinogen C
   complexed with ca, zn

Details for d1pytd_

PDB Entry: 1pyt, 2.35 Å

PDB Description: ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c

PDB Compounds: (D:) chymotrypsinogen c

SCOPe Domain Sequences for d1pytd_:

Sequence; same for both SEQRES and ATOM records:

>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgapifqpnlsarvvggedaiphswpwqislqylrdntwrhtcggtlitpnhvltaahci
sntltyrvalgknnlevedeagslyvgvdtifvhekwnsflvrndialiklaetvelgdt
iqvaclpsegsllpqdypcfvtgwgrlytngpiaaelqqglqpvvdyatcsqrdwwgttv
ketmvcaggdgvisacngdsggplncqadgqwdvrgivsfgsglscntfkkptvftrvsa
yidwinqklql

Timeline for d1pytd_:

• d1pytd_ first appeared (with stable ids) in SCOP 1.55
  
• d1pytd_ appears in SCOPe 2.05
  
• d1pytd_ appears in SCOPe 2.07
  
• d1pytd_ appears in the current release, SCOPe 2.08