Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [50523] (59 PDB entries) Uniprot P00766 |
Domain d1pytd_: 1pyt D: [26058] Other proteins in same PDB: d1pyta_, d1pytb_, d1pytc_ chymotrypsinogen C complexed with ca, zn |
PDB Entry: 1pyt (more details), 2.35 Å
SCOPe Domain Sequences for d1pytd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} cgapifqpnlsarvvggedaiphswpwqislqylrdntwrhtcggtlitpnhvltaahci sntltyrvalgknnlevedeagslyvgvdtifvhekwnsflvrndialiklaetvelgdt iqvaclpsegsllpqdypcfvtgwgrlytngpiaaelqqglqpvvdyatcsqrdwwgttv ketmvcaggdgvisacngdsggplncqadgqwdvrgivsfgsglscntfkkptvftrvsa yidwinqklql
Timeline for d1pytd_: