Lineage for d1pytd_ (1pyt D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953178Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 953179Species Cow (Bos taurus) [TaxId:9913] [50523] (57 PDB entries)
    Uniprot P00766
  8. 953245Domain d1pytd_: 1pyt D: [26058]
    Other proteins in same PDB: d1pyta_, d1pytb_, d1pytc_
    chymotrypsinogen C
    complexed with ca, zn

Details for d1pytd_

PDB Entry: 1pyt (more details), 2.35 Å

PDB Description: ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c
PDB Compounds: (D:) chymotrypsinogen c

SCOPe Domain Sequences for d1pytd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgapifqpnlsarvvggedaiphswpwqislqylrdntwrhtcggtlitpnhvltaahci
sntltyrvalgknnlevedeagslyvgvdtifvhekwnsflvrndialiklaetvelgdt
iqvaclpsegsllpqdypcfvtgwgrlytngpiaaelqqglqpvvdyatcsqrdwwgttv
ketmvcaggdgvisacngdsggplncqadgqwdvrgivsfgsglscntfkkptvftrvsa
yidwinqklql

SCOPe Domain Coordinates for d1pytd_:

Click to download the PDB-style file with coordinates for d1pytd_.
(The format of our PDB-style files is described here.)

Timeline for d1pytd_: