Lineage for d4qpod_ (4qpo D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328278Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2328279Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2328334Family a.55.1.2: DNA-binding domain (fragment?) of the TraM protein [63566] (2 proteins)
    old provisional classification awaiting the entire protein structure; structure of a different fragment of this protein (PDB 2g7o) is classified into a different superfamily
    automatically mapped to Pfam PF05261
  6. 2328338Protein automated matches [259492] (1 species)
    not a true protein
  7. 2328339Species Escherichia coli [TaxId:83333] [259493] (1 PDB entry)
  8. 2328343Domain d4qpod_: 4qpo D: [260577]
    automated match to d1dp3a_
    complexed with po4

Details for d4qpod_

PDB Entry: 4qpo (more details), 2 Å

PDB Description: Mechanistic basis of plasmid-specific DNA binding of the F plasmid regulatory protein, TraM
PDB Compounds: (D:) Relaxosome protein TraM

SCOPe Domain Sequences for d4qpod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qpod_ a.55.1.2 (D:) automated matches {Escherichia coli [TaxId: 83333]}
akvnlyisndayekinaiiekrrqegarekdvsfsatasmllelglrvheaq

SCOPe Domain Coordinates for d4qpod_:

Click to download the PDB-style file with coordinates for d4qpod_.
(The format of our PDB-style files is described here.)

Timeline for d4qpod_: