Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) |
Family a.118.1.27: Aminopeptidase N (APN) C-terminal-like [254179] (1 protein) PubMed 17876832; C-terminal part of Pfam PF11940 this is a repeat family; one repeat unit is 4pvb A:690-721 found in domain |
Protein Aminopeptidase N (APN) C-terminal domain [254402] (1 species) |
Species Neisseria meningitidis [TaxId:122586] [254838] (9 PDB entries) |
Domain d4qhpa4: 4qhp A:540-867 [260574] Other proteins in same PDB: d4qhpa1, d4qhpa2, d4qhpa3 automated match to d2gtqa4 complexed with 32q, 32r, gol, imd, so4, zn |
PDB Entry: 4qhp (more details), 1.6 Å
SCOPe Domain Sequences for d4qhpa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qhpa4 a.118.1.27 (A:540-867) Aminopeptidase N (APN) C-terminal domain {Neisseria meningitidis [TaxId: 122586]} pysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvis ddlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaa kqenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavn gnesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnk arsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrkn lvkqalqriraqeglskdvgeivgkild
Timeline for d4qhpa4: