Lineage for d4qhpa2 (4qhp A:189-438)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2571313Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
    adopts thermolysin-like fold
  6. 2571314Protein Aminopeptidase N (APN) catalytic domain [254400] (1 species)
  7. 2571315Species Neisseria meningitidis [TaxId:122586] [254836] (9 PDB entries)
  8. 2571317Domain d4qhpa2: 4qhp A:189-438 [260572]
    Other proteins in same PDB: d4qhpa1, d4qhpa3, d4qhpa4
    automated match to d2gtqa2
    complexed with 32q, 32r, gol, imd, so4, zn

Details for d4qhpa2

PDB Entry: 4qhp (more details), 1.6 Å

PDB Description: Crystal structure of Aminopeptidase N in complex with the phosphinic dipeptide analogue LL-(R,S)-hPheP[CH2]Phe(4-CH2NH2)
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4qhpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qhpa2 d.92.1.13 (A:189-438) Aminopeptidase N (APN) catalytic domain {Neisseria meningitidis [TaxId: 122586]}
dlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydldifmv
vavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnrvtcrd
wfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpasyeem
nnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamadangin
ldqfalwysq

SCOPe Domain Coordinates for d4qhpa2:

Click to download the PDB-style file with coordinates for d4qhpa2.
(The format of our PDB-style files is described here.)

Timeline for d4qhpa2: