Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins) adopts thermolysin-like fold |
Protein Aminopeptidase N (APN) catalytic domain [254400] (1 species) |
Species Neisseria meningitidis [TaxId:122586] [254836] (9 PDB entries) |
Domain d4qhpa2: 4qhp A:189-438 [260572] Other proteins in same PDB: d4qhpa1, d4qhpa3, d4qhpa4 automated match to d2gtqa2 complexed with 32q, 32r, gol, imd, so4, zn |
PDB Entry: 4qhp (more details), 1.6 Å
SCOPe Domain Sequences for d4qhpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qhpa2 d.92.1.13 (A:189-438) Aminopeptidase N (APN) catalytic domain {Neisseria meningitidis [TaxId: 122586]} dlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydldifmv vavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnrvtcrd wfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpasyeem nnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamadangin ldqfalwysq
Timeline for d4qhpa2: