Class b: All beta proteins [48724] (180 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins) |
Protein Aminopeptidase N (APN) N-terminal domain [254399] (1 species) |
Species Neisseria meningitidis [TaxId:122586] [254835] (9 PDB entries) |
Domain d4qhpa1: 4qhp A:2-188 [260571] Other proteins in same PDB: d4qhpa2, d4qhpa3, d4qhpa4 automated match to d2gtqa1 complexed with 32q, 32r, gol, imd, so4, zn |
PDB Entry: 4qhp (more details), 1.6 Å
SCOPe Domain Sequences for d4qhpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qhpa1 b.98.1.1 (A:2-188) Aminopeptidase N (APN) N-terminal domain {Neisseria meningitidis [TaxId: 122586]} sktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvk ingaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegf rkitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsy lfalvag
Timeline for d4qhpa1: