Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Escherichia coli [TaxId:536056] [260569] (1 PDB entry) |
Domain d4qc2a_: 4qc2 A: [260570] automated match to d2d2fa_ complexed with atp, mg |
PDB Entry: 4qc2 (more details), 2.22 Å
SCOPe Domain Sequences for d4qc2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qc2a_ c.37.1.0 (A:) automated matches {Escherichia coli [TaxId: 536056]} atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii iddddisllplhararrgigylpqeasifrrlsvydnlmavlqirddlsaeqredranel meefhiehlrdsmgqslsggerrrveiaralaanpkfilldepfagvdpisvidikriie hlrdsglgvlitdhnvretlavcerayivsqghliahgtpteilqdehvkrvylg
Timeline for d4qc2a_: