Lineage for d4qc2a_ (4qc2 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (136 species)
    not a true protein
  7. 2452167Species Escherichia coli [TaxId:536056] [260569] (1 PDB entry)
  8. 2452168Domain d4qc2a_: 4qc2 A: [260570]
    automated match to d2d2fa_
    complexed with atp, mg

Details for d4qc2a_

PDB Entry: 4qc2 (more details), 2.22 Å

PDB Description: crystal structure of lipopolysaccharide transport protein lptb in complex with atp and magnesium ions
PDB Compounds: (A:) ABC transporter related protein

SCOPe Domain Sequences for d4qc2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qc2a_ c.37.1.0 (A:) automated matches {Escherichia coli [TaxId: 536056]}
atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii
iddddisllplhararrgigylpqeasifrrlsvydnlmavlqirddlsaeqredranel
meefhiehlrdsmgqslsggerrrveiaralaanpkfilldepfagvdpisvidikriie
hlrdsglgvlitdhnvretlavcerayivsqghliahgtpteilqdehvkrvylg

SCOPe Domain Coordinates for d4qc2a_:

Click to download the PDB-style file with coordinates for d4qc2a_.
(The format of our PDB-style files is described here.)

Timeline for d4qc2a_: