Lineage for d4qa8a_ (4qa8 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077315Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
    11 stranded sheet partly folded in a corner-like structure filled with a few short helices
  4. 2077316Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) (S)
  5. 2077353Family b.125.1.0: automated matches [191645] (1 protein)
    not a true family
  6. 2077354Protein automated matches [191184] (3 species)
    not a true protein
  7. 2077355Species Mycobacterium bovis [TaxId:233413] [260565] (1 PDB entry)
  8. 2077356Domain d4qa8a_: 4qa8 A: [260566]
    automated match to d3mh9c_
    complexed with pjz

Details for d4qa8a_

PDB Entry: 4qa8 (more details), 1.1 Å

PDB Description: Crystal structure of LprF from Mycobacterium bovis
PDB Compounds: (A:) Putative lipoprotein LprF

SCOPe Domain Sequences for d4qa8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qa8a_ b.125.1.0 (A:) automated matches {Mycobacterium bovis [TaxId: 233413]}
gspspeaqqilqdsskatkglhsvhvvvtvnnlstlpfesvdadvtnqpqgngqavgnak
vrmkpntpvvateflvtnktmytkrggdyvsvgpaekiydpgiildkdrglgavvgqvqn
ptiqgrdaidglatvkvsgtidaavidpivpqlgkgggrlpitlwivdtnastpapaanl
vrmvidkdqgnvditlsnwgapvtipnpag

SCOPe Domain Coordinates for d4qa8a_:

Click to download the PDB-style file with coordinates for d4qa8a_.
(The format of our PDB-style files is described here.)

Timeline for d4qa8a_: