Lineage for d4pj0v_ (4pj0 V:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476826Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1476827Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1476828Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1477195Protein automated matches [190113] (15 species)
    not a true protein
  7. 1477234Species Thermosynechococcus elongatus [TaxId:197221] [260557] (1 PDB entry)
  8. 1477235Domain d4pj0v_: 4pj0 V: [260558]
    Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0z_
    automated match to d3bz2v_
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0v_

PDB Entry: 4pj0 (more details), 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing
PDB Compounds: (V:) cytochrome c-550

SCOPe Domain Sequences for d4pj0v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj0v_ a.3.1.1 (V:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d4pj0v_:

Click to download the PDB-style file with coordinates for d4pj0v_.
(The format of our PDB-style files is described here.)

Timeline for d4pj0v_: