Lineage for d4pj0j_ (4pj0 J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026440Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) (S)
    automatically mapped to Pfam PF01788
  5. 3026441Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 3026442Protein Photosystem II reaction center protein J, PsbJ [161023] (2 species)
  7. 3026443Species Thermosynechococcus elongatus [TaxId:146786] [161024] (3 PDB entries)
    Uniprot P59087 7-40
  8. 3026445Domain d4pj0j_: 4pj0 J: [260549]
    Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0k_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_
    automated match to d2axtj1
    complexed with bcr, bct, cl, cla, dgd, fe, hec, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0j_

PDB Entry: 4pj0 (more details), 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d4pj0j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj0j_ f.23.32.1 (J:) Photosystem II reaction center protein J, PsbJ {Thermosynechococcus elongatus [TaxId: 146786]}
riplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d4pj0j_:

Click to download the PDB-style file with coordinates for d4pj0j_.
(The format of our PDB-style files is described here.)

Timeline for d4pj0j_: