![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) ![]() automatically mapped to Pfam PF01788 |
![]() | Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
![]() | Protein Photosystem II reaction center protein J, PsbJ [161023] (2 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [161024] (3 PDB entries) Uniprot P59087 7-40 |
![]() | Domain d4pj0j_: 4pj0 J: [260549] Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0k_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0x_, d4pj0z_ automated match to d2axtj1 complexed with bcr, bct, cl, cla, dgd, fe, hec, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl |
PDB Entry: 4pj0 (more details), 2.44 Å
SCOPe Domain Sequences for d4pj0j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj0j_ f.23.32.1 (J:) Photosystem II reaction center protein J, PsbJ {Thermosynechococcus elongatus [TaxId: 146786]} riplwivatvagmgvivivglffygayaglgssl
Timeline for d4pj0j_: