Lineage for d4pj0a_ (4pj0 A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958788Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1958789Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1958790Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1958970Protein automated matches [190224] (7 species)
    not a true protein
  7. 1959055Species Thermosynechococcus elongatus [TaxId:197221] [260543] (1 PDB entry)
  8. 1959056Domain d4pj0a_: 4pj0 A: [260548]
    Other proteins in same PDB: d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0z_
    automated match to d2axta1
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0a_

PDB Entry: 4pj0 (more details), 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing
PDB Compounds: (A:) photosystem q(b) protein 1

SCOPe Domain Sequences for d4pj0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj0a_ f.26.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
nlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgsl
lygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrqw
elsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaehn
ilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetynivaa
hgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvidakg
nvintwadiinranlgmevmhernahnfpldla

SCOPe Domain Coordinates for d4pj0a_:

Click to download the PDB-style file with coordinates for d4pj0a_.
(The format of our PDB-style files is described here.)

Timeline for d4pj0a_: