Lineage for d4olzl1 (4olz L:3-107)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356268Domain d4olzl1: 4olz L:3-107 [260535]
    automated match to d4lstl1
    complexed with nag

Details for d4olzl1

PDB Entry: 4olz (more details), 2.1 Å

PDB Description: crystal structure of antibody vrc07-g54w in complex with clade a/e 93th057 hiv-1 gp120 core
PDB Compounds: (L:) Antigen binding fragment of light chain: Antibody VRC01

SCOPe Domain Sequences for d4olzl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4olzl1 b.1.1.0 (L:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqspgtlslspgetaiiscrtsqygslawyqqrpgqaprlviysgstraagipdrfsg
srwgpdynltisnlesgdfgvyycqqyeffgqgtkvqvd

SCOPe Domain Coordinates for d4olzl1:

Click to download the PDB-style file with coordinates for d4olzl1.
(The format of our PDB-style files is described here.)

Timeline for d4olzl1: