Lineage for d4p0ib_ (4p0i B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1626115Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1626116Protein automated matches [190039] (87 species)
    not a true protein
  7. 1626138Species Agrobacterium tumefaciens [TaxId:176299] [260526] (3 PDB entries)
  8. 1626143Domain d4p0ib_: 4p0i B: [260532]
    automated match to d2m8ca_
    complexed with edo, peg

Details for d4p0ib_

PDB Entry: 4p0i (more details), 1.89 Å

PDB Description: Structure of the PBP NocT
PDB Compounds: (B:) Nopaline-binding periplasmic protein

SCOPe Domain Sequences for d4p0ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p0ib_ c.94.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
dyksitiategsyapynfkdaggkligfdidlgndlckrmnieckfveqawdgiipslta
grydaimaamgiqparekviafsrpylltpmtflttadspllktqvaienlpldnitpeq
kaeldkftkifegvkfgvqagtsheafmkqmmpsvqistydtidnvvmdlkagridasla
svsflkpltdkpdnkdlkmfgprmtgglfgkgvgvgirkedadlkalfdkaidaaiadgt
vqklsqqwfgydaspk

SCOPe Domain Coordinates for d4p0ib_:

Click to download the PDB-style file with coordinates for d4p0ib_.
(The format of our PDB-style files is described here.)

Timeline for d4p0ib_: