Lineage for d4olvl2 (4olv L:108-216)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (919 PDB entries)
  8. 2027727Domain d4olvl2: 4olv L:108-216 [260531]
    automated match to d4lssl2
    complexed with nag

Details for d4olvl2

PDB Entry: 4olv (more details), 2.5 Å

PDB Description: crystal structure of antibody vrc07-g54f in complex with clade a/e 93th057 hiv-1 gp120 core
PDB Compounds: (L:) Antigen binding fragment of light chain: Antibody VRC01

SCOPe Domain Sequences for d4olvl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4olvl2 b.1.1.0 (L:108-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvte
qdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d4olvl2:

Click to download the PDB-style file with coordinates for d4olvl2.
(The format of our PDB-style files is described here.)

Timeline for d4olvl2: