Class b: All beta proteins [48724] (126 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins) |
Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [50523] (46 PDB entries) |
Domain d1dlk.1: 1dlk A:,B: [26051] |
PDB Entry: 1dlk (more details), 2.14 Å
SCOP Domain Sequences for d1dlk.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1dlk.1 b.47.1.2 (A:,B:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)} cgvpaiqpvlsglXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvt tsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsav clpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdami cagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqt laan
Timeline for d1dlk.1:
View in 3D Domains from other chains: (mouse over for more information) d1dlk.2, d1dlk.2, d1dlk.2, d1dlk.2 |