Lineage for d4m8ta_ (4m8t A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2222093Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2222094Protein automated matches [190417] (25 species)
    not a true protein
  7. 2223590Species Mouse (Mus musculus) [TaxId:10090] [194605] (24 PDB entries)
  8. 2223620Domain d4m8ta_: 4m8t A: [260509]
    automated match to d2bdwa_
    complexed with na, rmm

Details for d4m8ta_

PDB Entry: 4m8t (more details), 3 Å

PDB Description: RSK2 T493M C-Terminal Kinase Domain in complex with 3-(3-(1H-pyrazol-4-yl)phenyl)-2-cyanoacrylamide
PDB Compounds: (A:) Ribosomal protein S6 kinase alpha-3

SCOPe Domain Sequences for d4m8ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m8ta_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlhrnsiqftdgyevkedigvgsysvckrcihkatnmefavkiidkskrdpteeieillr
ygqhpniitlkdvyddgkyvyvvmelmkggelldkilrqkffsereasavlftitktvey
lhaqgvvhrdlkpsnilyvdesgnpesiricdfgfakqlraengllmtpcytanfvapev
lerqgydaacdiwslgvllytmltgytpfangpddtpeeilarigsgkfslsggywnsvs
dtakdlvskmlhvdphqrltaalvlrhpwivhwdqlpqyqlnrqdaphlvkgamaatysa
lnr

SCOPe Domain Coordinates for d4m8ta_:

Click to download the PDB-style file with coordinates for d4m8ta_.
(The format of our PDB-style files is described here.)

Timeline for d4m8ta_: