Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (25 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [194605] (24 PDB entries) |
Domain d4m8ta_: 4m8t A: [260509] automated match to d2bdwa_ complexed with na, rmm |
PDB Entry: 4m8t (more details), 3 Å
SCOPe Domain Sequences for d4m8ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m8ta_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qlhrnsiqftdgyevkedigvgsysvckrcihkatnmefavkiidkskrdpteeieillr ygqhpniitlkdvyddgkyvyvvmelmkggelldkilrqkffsereasavlftitktvey lhaqgvvhrdlkpsnilyvdesgnpesiricdfgfakqlraengllmtpcytanfvapev lerqgydaacdiwslgvllytmltgytpfangpddtpeeilarigsgkfslsggywnsvs dtakdlvskmlhvdphqrltaalvlrhpwivhwdqlpqyqlnrqdaphlvkgamaatysa lnr
Timeline for d4m8ta_: