Lineage for d4maoa_ (4mao A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2987271Species Mouse (Mus musculus) [TaxId:10090] [194605] (31 PDB entries)
  8. 2987300Domain d4maoa_: 4mao A: [260508]
    automated match to d2bdwa_
    complexed with 28d, na

Details for d4maoa_

PDB Entry: 4mao (more details), 2.6 Å

PDB Description: RSK2 T493M C-Terminal Kinase Domain in Complex with RMM58
PDB Compounds: (A:) Ribosomal protein S6 kinase alpha-3

SCOPe Domain Sequences for d4maoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4maoa_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
siqftdgyevkedigvgsysvckrcihkatnmefavkiidkskrdpteeieillrygqhp
niitlkdvyddgkyvyvvmelmkggelldkilrqkffsereasavlftitktveylhaqg
vvhrdlkpsnilyvdesgnpesiricdfgfakqlraengllmtpcytanfvapevlerqg
ydaacdiwslgvllytmltgytpfangpddtpeeilarigsgkfslsggywnsvsdtakd
lvskmlhvdphqrltaalvlrhpwivhwdqlpqyqlnrqdaphlvkgamaatysalnr

SCOPe Domain Coordinates for d4maoa_:

Click to download the PDB-style file with coordinates for d4maoa_.
(The format of our PDB-style files is described here.)

Timeline for d4maoa_: