Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [194605] (31 PDB entries) |
Domain d4maoa_: 4mao A: [260508] automated match to d2bdwa_ complexed with 28d, na |
PDB Entry: 4mao (more details), 2.6 Å
SCOPe Domain Sequences for d4maoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4maoa_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} siqftdgyevkedigvgsysvckrcihkatnmefavkiidkskrdpteeieillrygqhp niitlkdvyddgkyvyvvmelmkggelldkilrqkffsereasavlftitktveylhaqg vvhrdlkpsnilyvdesgnpesiricdfgfakqlraengllmtpcytanfvapevlerqg ydaacdiwslgvllytmltgytpfangpddtpeeilarigsgkfslsggywnsvsdtakd lvskmlhvdphqrltaalvlrhpwivhwdqlpqyqlnrqdaphlvkgamaatysalnr
Timeline for d4maoa_: