SCOPe 2.06: Domain d4mypb_: 4myp B:

Lineage for d4mypb_ (4myp B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.0: automated matches [195425] (1 protein)
   not a true family

6. Protein automated matches [195426] (6 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:1639] [260500] (2 PDB entries)

8. Domain d4mypb_: 4myp B: [260503]
   automated match to d3sika_
   complexed with gol, hem, zn

Details for d4mypb_

PDB Entry: 4myp, 1.8 Å

PDB Description: Structure of the central NEAT domain, N2, of the listerial Hbp2 protein complexed with heme

PDB Compounds: (B:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d4mypb_:

Sequence; same for both SEQRES and ATOM records:

>d4mypb_ b.1.28.0 (B:) automated matches {Listeria monocytogenes [TaxId: 1639]}
giytipfvakkanddsnssmqnyfnnpawlkvkngkkmvamtvndnktvtalkttlagtl
qdvkvvsedkdantrivefevedlnqplaahvnyeapfngsvykgqadfryvfdtak

Timeline for d4mypb_:

• d4mypb_ first appeared in SCOPe 2.04
  
• d4mypb_ appears in SCOPe 2.05
  
• d4mypb_ appears in SCOPe 2.07
  
• d4mypb_ appears in the current release, SCOPe 2.08