Lineage for d4mypb_ (4myp B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766795Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2766841Family b.1.28.0: automated matches [195425] (1 protein)
    not a true family
  6. 2766842Protein automated matches [195426] (7 species)
    not a true protein
  7. 2766852Species Listeria monocytogenes [TaxId:1639] [260500] (2 PDB entries)
  8. 2766854Domain d4mypb_: 4myp B: [260503]
    automated match to d3sika_
    complexed with gol, hem, zn

Details for d4mypb_

PDB Entry: 4myp (more details), 1.8 Å

PDB Description: Structure of the central NEAT domain, N2, of the listerial Hbp2 protein complexed with heme
PDB Compounds: (B:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d4mypb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mypb_ b.1.28.0 (B:) automated matches {Listeria monocytogenes [TaxId: 1639]}
giytipfvakkanddsnssmqnyfnnpawlkvkngkkmvamtvndnktvtalkttlagtl
qdvkvvsedkdantrivefevedlnqplaahvnyeapfngsvykgqadfryvfdtak

SCOPe Domain Coordinates for d4mypb_:

Click to download the PDB-style file with coordinates for d4mypb_.
(The format of our PDB-style files is described here.)

Timeline for d4mypb_: