SCOP 1.73: Domain d6gch.1: 6gch E:,F:,G:

Lineage for d6gch.1 (6gch E:,F:,G:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (56 PDB entries)

8. Domain d6gch.1: 6gch E:,F:,G: [26050]
   complexed with apf

Details for d6gch.1

PDB Entry: 6gch, 2.1 Å

PDB Description: structure of chymotrypsin-*trifluoromethyl ketone inhibitor complexes. comparison of slowly and rapidly equilibrating inhibitors

PDB Compounds: (E:) gamma-chymotrypsin a, (F:) gamma-chymotrypsin a, (G:) gamma-chymotrypsin a

SCOP Domain Sequences for d6gch.1:

Sequence; same for both SEQRES and ATOM records:

>g6gch.1 b.47.1.2 (E:,F:,G:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
psasddfaagttcvttgwgltryXtpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

Timeline for d6gch.1:

• d6gch.1 first appeared (with stable ids) in SCOP 1.55, called d6gch__
  
• d6gch.1 was called d6gch__ in SCOP 1.71
  
• d6gch.1 appears in SCOP 1.75
  
• d6gch.1 appears in the current release, SCOPe 2.08