SCOPe 2.08: Domain d3gcha_: 3gch A:,B:,C:

Lineage for d3gcha_ (3gch A:,B:,C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries)
   Uniprot P00766

8. Domain d3gcha_: 3gch A:,B:,C: [26049]
   complexed with oac

Details for d3gcha_

PDB Entry: 3gch, 1.9 Å

PDB Description: chemistry of caged enzymes. binding of photoreversible cinnamates to chymotrypsin

PDB Compounds: (A:) gamma-chymotrypsin, (B:) gamma-chymotrypsin, (C:) gamma-chymotrypsin

SCOPe Domain Sequences for d3gcha_:

Sequence; same for both SEQRES and ATOM records:

>g3gcha_ b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
psasddfaagttcvttgwgltryXtpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

Timeline for d3gcha_:

• d3gcha_ first appeared (with stable ids) in SCOP 1.55, called d3gch__
  
• d3gcha_ appears in SCOPe 2.07