Lineage for d4k6ua_ (4k6u A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2776829Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2776830Protein Adenovirus fiber protein 'knob' domain [49837] (18 species)
  7. 2776855Species Human adenovirus 37 [TaxId:52275] [110136] (11 PDB entries)
    Uniprot Q64823 182-365 ! Uniprot Q64823 181-365
  8. 2776877Domain d4k6ua_: 4k6u A: [260487]
    automated match to d1uxaa_
    complexed with 1p4, act, sia, zn

Details for d4k6ua_

PDB Entry: 4k6u (more details), 1.9 Å

PDB Description: crystal structure of ad37 fiber knob in complex with trivalent sialic acid inhibitor me0386
PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d4k6ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k6ua_ b.21.1.1 (A:) Adenovirus fiber protein 'knob' domain {Human adenovirus 37 [TaxId: 52275]}
dtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpki
ksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskk
yardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsy
iaqe

SCOPe Domain Coordinates for d4k6ua_:

Click to download the PDB-style file with coordinates for d4k6ua_.
(The format of our PDB-style files is described here.)

Timeline for d4k6ua_: