Lineage for d4d1nd_ (4d1n D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1683350Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1683351Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1683352Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1683973Protein automated matches [190421] (5 species)
    not a true protein
  7. 1684005Species Human (Homo sapiens) [TaxId:9606] [187302] (6 PDB entries)
  8. 1684017Domain d4d1nd_: 4d1n D: [260482]
    automated match to d3hsob_
    complexed with arg, gol, h4b, hem, zn

Details for d4d1nd_

PDB Entry: 4d1n (more details), 2.03 Å

PDB Description: Structure of human nNOS heme domain with L-Arg bound
PDB Compounds: (D:) Nitric oxide synthase, brain

SCOPe Domain Sequences for d4d1nd_:

Sequence, based on SEQRES records: (download)

>d4d1nd_ d.174.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

Sequence, based on observed residues (ATOM records): (download)

>d4d1nd_ d.174.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpvatkdqlfplakefidqy
yssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgriqwsklq
vfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagy
kqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippelvlevp
irhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsryn
ileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmene
yrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

SCOPe Domain Coordinates for d4d1nd_:

Click to download the PDB-style file with coordinates for d4d1nd_.
(The format of our PDB-style files is described here.)

Timeline for d4d1nd_: