Lineage for d3wxca_ (3wxc A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996767Species Pseudomonas aeruginosa, IMP-1 [TaxId:287] [56287] (7 PDB entries)
  8. 2996776Domain d3wxca_: 3wxc A: [260474]
    automated match to d1jjea_
    complexed with c93, zn

Details for d3wxca_

PDB Entry: 3wxc (more details), 2.1 Å

PDB Description: Crystal Structure of IMP-1 metallo-beta-lactamase complexed with a 3-aminophtalic acid inhibitor
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3wxca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wxca_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglnes

SCOPe Domain Coordinates for d3wxca_:

Click to download the PDB-style file with coordinates for d3wxca_.
(The format of our PDB-style files is described here.)

Timeline for d3wxca_: