SCOPe 2.06: Domain d4w90b_: 4w90 B:

Lineage for d4w90b_ (4w90 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)

8. Domain d4w90b_: 4w90 B: [260464]
   automated match to d2nz4b_
   protein/RNA complex; complexed with 2ba, mg

Details for d4w90b_

PDB Entry: 4w90, 3.12 Å

PDB Description: crystal structure of bacillus subtilis cyclic-di-amp riboswitch ydao

PDB Compounds: (B:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d4w90b_:

Sequence; same for both SEQRES and ATOM records:

>d4w90b_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiak

Timeline for d4w90b_:

• d4w90b_ first appeared in SCOPe 2.04
  
• d4w90b_ appears in SCOPe 2.05
  
• d4w90b_ appears in SCOPe 2.07
  
• d4w90b_ appears in the current release, SCOPe 2.08