Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein automated matches [190332] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries) |
Domain d4w90b_: 4w90 B: [260464] automated match to d2nz4b_ protein/RNA complex; complexed with 2ba, mg |
PDB Entry: 4w90 (more details), 3.12 Å
SCOPe Domain Sequences for d4w90b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w90b_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat nalrsmqgfpfydkpmriqyaktdsdiiak
Timeline for d4w90b_: