Lineage for d4w90b_ (4w90 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908891Protein automated matches [190332] (4 species)
    not a true protein
  7. 1908892Species Human (Homo sapiens) [TaxId:9606] [187155] (24 PDB entries)
  8. 1908939Domain d4w90b_: 4w90 B: [260464]
    automated match to d2nz4b_
    protein/RNA complex; complexed with 2ba, mg

Details for d4w90b_

PDB Entry: 4w90 (more details), 3.12 Å

PDB Description: crystal structure of bacillus subtilis cyclic-di-amp riboswitch ydao
PDB Compounds: (B:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d4w90b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w90b_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiak

SCOPe Domain Coordinates for d4w90b_:

Click to download the PDB-style file with coordinates for d4w90b_.
(The format of our PDB-style files is described here.)

Timeline for d4w90b_: