SCOPe 2.08: Domain d4w4lb_: 4w4l B:

Lineage for d4w4lb_ (4w4l B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle

5. Family a.25.4.2: PPE [140463] (2 proteins)
   Pfam PF00823; contains extra C-terminal alpha-hairpin, unlike the PE family subunit

6. Protein PPE41 [140464] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140465] (3 PDB entries)
   Uniprot Q79FE1 2-174

8. Domain d4w4lb_: 4w4l B: [260463]
   Other proteins in same PDB: d4w4la_
   automated match to d2g38b1
   complexed with edo

Details for d4w4lb_

PDB Entry: 4w4l, 2.45 Å

PDB Description: crystal structure of espg5 in complex with pe25 and ppe41 from the esx-5 type vii secretion system of m. tuberculosis

PDB Compounds: (B:) PPE family protein PPE41

SCOPe Domain Sequences for d4w4lb_:

Sequence; same for both SEQRES and ATOM records:

>d4w4lb_ a.25.4.2 (B:) PPE41 {Mycobacterium tuberculosis [TaxId: 1773]}
mhfeayppevnsaniyagpgpdsmlaaarawrsldvemtavqrsfnrtllslmdawagpv
vmqlmeaakpfvrwltdlcvqlseverqiheivrayewahhdmvplaqiynnraerqili
dnnalgqftaqiadldqeyddfwdedgevmrdyrlrvsdalskltpwkapppia

Timeline for d4w4lb_:

• d4w4lb_ first appeared in SCOPe 2.04
  
• d4w4lb_ appears in SCOPe 2.07