Lineage for d4w4lb_ (4w4l B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2705398Superfamily a.25.4: PE/PPE dimer-like [140459] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals inside the bundle
  5. 2705412Family a.25.4.2: PPE [140463] (2 proteins)
    Pfam PF00823; contains extra C-terminal alpha-hairpin, unlike the PE family subunit
  6. 2705413Protein PPE41 [140464] (1 species)
  7. 2705414Species Mycobacterium tuberculosis [TaxId:1773] [140465] (3 PDB entries)
    Uniprot Q79FE1 2-174
  8. 2705419Domain d4w4lb_: 4w4l B: [260463]
    Other proteins in same PDB: d4w4la_
    automated match to d2g38b1
    complexed with edo

Details for d4w4lb_

PDB Entry: 4w4l (more details), 2.45 Å

PDB Description: crystal structure of espg5 in complex with pe25 and ppe41 from the esx-5 type vii secretion system of m. tuberculosis
PDB Compounds: (B:) PPE family protein PPE41

SCOPe Domain Sequences for d4w4lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w4lb_ a.25.4.2 (B:) PPE41 {Mycobacterium tuberculosis [TaxId: 1773]}
mhfeayppevnsaniyagpgpdsmlaaarawrsldvemtavqrsfnrtllslmdawagpv
vmqlmeaakpfvrwltdlcvqlseverqiheivrayewahhdmvplaqiynnraerqili
dnnalgqftaqiadldqeyddfwdedgevmrdyrlrvsdalskltpwkapppia

SCOPe Domain Coordinates for d4w4lb_:

Click to download the PDB-style file with coordinates for d4w4lb_.
(The format of our PDB-style files is described here.)

Timeline for d4w4lb_: