![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein automated matches [190139] (27 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [260458] (12 PDB entries) |
![]() | Domain d4uy1a_: 4uy1 A: [260459] automated match to d1le6a_ complexed with 1pe, ca, dms, peg, tjm |
PDB Entry: 4uy1 (more details), 2.2 Å
SCOPe Domain Sequences for d4uy1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uy1a_ a.133.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp kc
Timeline for d4uy1a_: