Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (26 species) not a true protein |
Species Clostridium perfringens [TaxId:195102] [260453] (3 PDB entries) |
Domain d4utua_: 4utu A: [260456] automated match to d1yxya1 complexed with cl, lry |
PDB Entry: 4utu (more details), 1.45 Å
SCOPe Domain Sequences for d4utua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4utua_ c.1.2.0 (A:) automated matches {Clostridium perfringens [TaxId: 195102]} gsshhhhhhmldvvkgnlivscqalsdeplhssfimgrmaiaakqggaaairaqgvndin eikevtklpiigiiarnyddseiyitptmkevdellktdcemialdatkrkrpngenvkd lvdaihakgrlamadistleegieaeklgfdcvsttlsgytpyskqsnsvdfelleelvk tvkipvicegrintpeelkkaldlgaysavvggaitrpqqitkrftdil
Timeline for d4utua_: