SCOPe 2.05: Domain d4utua_: 4utu A:

Lineage for d4utua_ (4utu A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (26 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:195102] [260453] (3 PDB entries)

8. Domain d4utua_: 4utu A: [260456]
   automated match to d1yxya1
   complexed with cl, lry

Details for d4utua_

PDB Entry: 4utu, 1.45 Å

PDB Description: Structural and biochemical characterization of the N- acetylmannosamine-6-phosphate 2-epimerase from Clostridium perfringens

PDB Compounds: (A:) N-acetylmannosamine-6-phosphate 2-epimerase

SCOPe Domain Sequences for d4utua_:

Sequence; same for both SEQRES and ATOM records:

>d4utua_ c.1.2.0 (A:) automated matches {Clostridium perfringens [TaxId: 195102]}
gsshhhhhhmldvvkgnlivscqalsdeplhssfimgrmaiaakqggaaairaqgvndin
eikevtklpiigiiarnyddseiyitptmkevdellktdcemialdatkrkrpngenvkd
lvdaihakgrlamadistleegieaeklgfdcvsttlsgytpyskqsnsvdfelleelvk
tvkipvicegrintpeelkkaldlgaysavvggaitrpqqitkrftdil

Timeline for d4utua_:

• d4utua_ first appeared in SCOPe 2.04
  
• d4utua_ is called d4utua1 in SCOPe 2.06
  
• d4utua_ appears in the current release, SCOPe 2.08, called d4utua1