SCOPe 2.04: Domain d4u32a_: 4u32 A:

Lineage for d4u32a_ (4u32 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (9 PDB entries)

8. Domain d4u32a_: 4u32 A: [260450]
   Other proteins in same PDB: d4u32x_
   automated match to d3p95a_
   complexed with ca, nag

Details for d4u32a_

PDB Entry: 4u32, 1.65 Å

PDB Description: human mesotrypsin complexed with hai-2 kunitz domain 1

PDB Compounds: (A:) Trypsin-3

SCOPe Domain Sequences for d4u32a_:

Sequence; same for both SEQRES and ATOM records:

>d4u32a_ b.47.1.2 (A:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]}
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans

Timeline for d4u32a_:

• d4u32a_ is new in SCOPe 2.04-stable
  
• d4u32a_ appears in SCOPe 2.05
  
• d4u32a_ appears in the current release, SCOPe 2.08