Lineage for d4u32x_ (4u32 X:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259689Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 2259690Protein automated matches [190829] (11 species)
    not a true protein
  7. 2259716Species Human (Homo sapiens) [TaxId:9606] [188132] (8 PDB entries)
  8. 2259717Domain d4u32x_: 4u32 X: [260449]
    Other proteins in same PDB: d4u32a_
    automated match to d4isnb_
    complexed with ca, nag

Details for d4u32x_

PDB Entry: 4u32 (more details), 1.65 Å

PDB Description: Human mesotrypsin complexed with HAI-2 Kunitz domain 1
PDB Compounds: (X:) Kunitz-type protease inhibitor 2

SCOPe Domain Sequences for d4u32x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u32x_ g.8.1.0 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hdfclvskvvgrcrasmprwwynvtdgscqlfvyggcdgnsnnyltkeeclkkc

SCOPe Domain Coordinates for d4u32x_:

Click to download the PDB-style file with coordinates for d4u32x_.
(The format of our PDB-style files is described here.)

Timeline for d4u32x_: