Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (20 species) not a true protein |
Species Bradyrhizobium diazoefficiens [TaxId:224911] [260055] (2 PDB entries) |
Domain d4txoc_: 4txo C: [260446] Other proteins in same PDB: d4txob_, d4txod_, d4txof_, d4txoh_ automated match to d1jfub_ complexed with na, peg, scn |
PDB Entry: 4txo (more details), 2.2 Å
SCOPe Domain Sequences for d4txoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4txoc_ c.47.1.10 (C:) automated matches {Bradyrhizobium diazoefficiens [TaxId: 224911]} tgdpacraavataqkiaplahgevaaltmasaplklpdlafedadgkpkklsdfrgktll vnlwatwcvpsrkempaldelqgklsgpnfevvainidtrdpekpktflkeanltrlgyf ndqkakvfqdlkaigralgmptsvlvdpqgceiatiagpaewasedalkliraatgk
Timeline for d4txoc_: