Lineage for d4txoc_ (4txo C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2485379Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2485823Protein automated matches [190100] (20 species)
    not a true protein
  7. 2486091Species Bradyrhizobium diazoefficiens [TaxId:224911] [260055] (2 PDB entries)
  8. 2486095Domain d4txoc_: 4txo C: [260446]
    Other proteins in same PDB: d4txob_, d4txod_, d4txof_, d4txoh_
    automated match to d1jfub_
    complexed with na, peg, scn

Details for d4txoc_

PDB Entry: 4txo (more details), 2.2 Å

PDB Description: crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s)
PDB Compounds: (C:) thiol:disulfide interchange protein tlpa

SCOPe Domain Sequences for d4txoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4txoc_ c.47.1.10 (C:) automated matches {Bradyrhizobium diazoefficiens [TaxId: 224911]}
tgdpacraavataqkiaplahgevaaltmasaplklpdlafedadgkpkklsdfrgktll
vnlwatwcvpsrkempaldelqgklsgpnfevvainidtrdpekpktflkeanltrlgyf
ndqkakvfqdlkaigralgmptsvlvdpqgceiatiagpaewasedalkliraatgk

SCOPe Domain Coordinates for d4txoc_:

Click to download the PDB-style file with coordinates for d4txoc_.
(The format of our PDB-style files is described here.)

Timeline for d4txoc_: