Lineage for d4tx0a_ (4tx0 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1644292Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1644293Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1644294Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1644518Protein automated matches [191209] (3 species)
    not a true protein
  7. 1644519Species Human (Homo sapiens) [TaxId:9606] [189839] (36 PDB entries)
  8. 1644531Domain d4tx0a_: 4tx0 A: [260444]
    automated match to d3o5qa_
    complexed with 384

Details for d4tx0a_

PDB Entry: 4tx0 (more details), 1.03 Å

PDB Description: The Fk1 domain of FKBP51 in complex with (1S,5S,6R)-10-[(3,5-dichlorophenyl)sulfonyl]-5-(2-methoxyethoxy)-3-(2-methoxyethyl)-3,10-diazabicyclo[4.3.1]decan-2-one
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d4tx0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tx0a_ d.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
elldfkge

SCOPe Domain Coordinates for d4tx0a_:

Click to download the PDB-style file with coordinates for d4tx0a_.
(The format of our PDB-style files is described here.)

Timeline for d4tx0a_: