![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
![]() | Protein automated matches [191209] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189839] (36 PDB entries) |
![]() | Domain d4tx0a_: 4tx0 A: [260444] automated match to d3o5qa_ complexed with 384 |
PDB Entry: 4tx0 (more details), 1.03 Å
SCOPe Domain Sequences for d4tx0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tx0a_ d.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei elldfkge
Timeline for d4tx0a_: