SCOPe 2.04: Domain d4tw3a_: 4tw3 A:

Lineage for d4tw3a_ (4tw3 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.6: PMT1231-like [158402] (2 proteins)
   PfamB PB016165
   automatically mapped to Pfam PF11266

6. Protein Hypothetical protein PMT1231 [158403] (1 species)

7. Species Prochlorococcus marinus [TaxId:1219] [158404] (7 PDB entries)
   Uniprot Q7V6D4 20-241

8. Domain d4tw3a_: 4tw3 A: [260443]
   automated match to d4kvqa_
   complexed with edo, fe, ste

Details for d4tw3a_

PDB Entry: 4tw3, 1.6 Å

PDB Description: Insights into Substrate and Metal Binding from the Crystal Structure of Cyanobacterial Aldehyde Deformylating Oxygenase with Substrate Bound

PDB Compounds: (A:) Aldehyde decarbonylase

SCOPe Domain Sequences for d4tw3a_:

Sequence; same for both SEQRES and ATOM records:

>d4tw3a_ a.25.1.6 (A:) Hypothetical protein PMT1231 {Prochlorococcus marinus [TaxId: 1219]}
alpdftsdrykdaysrinaiviegeqeahdnyiaigtllpdhveelkrlakmemrhkkgf
tacgknlgvkadmdfareffaplrdnfqtalgqgktptclliqallieafaisayhtyip
vsdpfarkitegvvkdeythlnygeawlkanlescreelleanrenlplirrmldqvagd
aavlqmdkedliedfliayqeslteigfntreitrmaaaalv

Timeline for d4tw3a_:

• d4tw3a_ is new in SCOPe 2.04-stable
  
• d4tw3a_ appears in SCOPe 2.05
  
• d4tw3a_ appears in the current release, SCOPe 2.08