SCOPe 2.05: Domain d4tuha_: 4tuh A:

Lineage for d4tuha_ (4tuh A:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (32 PDB entries)

8. Domain d4tuha_: 4tuh A: [260442]
   automated match to d1ysga_
   complexed with 38h, act, edo

Details for d4tuha_

PDB Entry: 4tuh, 1.8 Å

PDB Description: bcl-xl in complex with inhibitor (compound 10)

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d4tuha_:

Sequence; same for both SEQRES and ATOM records:

>d4tuha_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
plgsmsqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsql
hitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmat
ylndhlepwiqenggwdtfvelyg

Timeline for d4tuha_:

• d4tuha_ first appeared in SCOPe 2.04
  
• d4tuha_ is called d4tuha1 in SCOPe 2.06
  
• d4tuha_ appears in the current release, SCOPe 2.08, called d4tuha1