Lineage for d4toqb_ (4toq B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083165Family c.1.8.5: Type II chitinase [51534] (15 protein domains)
    glycosylase family 18
  6. 2083399Protein automated matches [190666] (2 species)
    not a true protein
  7. 2083402Species Punica granatum [TaxId:22663] [259533] (1 PDB entry)
  8. 2083404Domain d4toqb_: 4toq B: [260441]
    automated match to d2hvma_
    complexed with cl, mg

Details for d4toqb_

PDB Entry: 4toq (more details), 1.6 Å

PDB Description: crystal structure of class iii chitinase from pomegranate provides the insight into its metal storage capacity
PDB Compounds: (B:) Class III chitinase

SCOPe Domain Sequences for d4toqb_:

Sequence, based on SEQRES records: (download)

>d4toqb_ c.1.8.5 (B:) automated matches {Punica granatum [TaxId: 22663]}
gdiaiywgqnggegtlastcdtgryayvivsfvttfgnfrapvvnlaghcdpaagtctgl
sdeirscqgkdikvlmsigggagdyslvseadadnfadylwnnflggqsssrplgdavld
gidfdielgtttfydtlaralssrstqaakvyltaapqcphpdshldaalntglfdnvwi
qfynnplaqcqyssgntndilsswntwtssttagkiflglpaapeaagsgyippdvltgq
ilpqiktsakyggvmlyskfydttysttikdqv

Sequence, based on observed residues (ATOM records): (download)

>d4toqb_ c.1.8.5 (B:) automated matches {Punica granatum [TaxId: 22663]}
gdiaiywgqnggegtlastcdtgryayvivsfvttfgnfrapvvnlaghcdpaagtctgl
sdeirscqgkdikvlmsigggagdyslvseadadnfadylwnnflggqsssrplgdavld
gidfdielgtttfydtlaralssrsakvyltaapqcphpdshldaalntglfdnvwiqfy
nnplaqcqyssgntndilsswntwtssttagkiflglpaapeaagsgyippdvltgqilp
qiktsakyggvmlyskfydttysttikdqv

SCOPe Domain Coordinates for d4toqb_:

Click to download the PDB-style file with coordinates for d4toqb_.
(The format of our PDB-style files is described here.)

Timeline for d4toqb_: