Lineage for d4tljb_ (4tlj B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2062523Family b.60.1.1: Retinol binding protein-like [50815] (22 protein domains)
    barrel, closed; n=8, S=12, meander
  6. 2062546Protein beta-Lactoglobulin [50827] (4 species)
  7. 2062606Species Goat (Capra hircus) [TaxId:9925] [267757] (2 PDB entries)
  8. 2062608Domain d4tljb_: 4tlj B: [260440]
    automated match to d4nlja_
    complexed with bu1

Details for d4tljb_

PDB Entry: 4tlj (more details), 1.17 Å

PDB Description: ultra-high resolution crystal structure of caprine beta-lactoglobulin
PDB Compounds: (B:) beta-lactoglobulin

SCOPe Domain Sequences for d4tljb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tljb_ b.60.1.1 (B:) beta-Lactoglobulin {Goat (Capra hircus) [TaxId: 9925]}
iivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegnleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevdkealekfdkalkalpmhirlafnptqlegqchv

SCOPe Domain Coordinates for d4tljb_:

Click to download the PDB-style file with coordinates for d4tljb_.
(The format of our PDB-style files is described here.)

Timeline for d4tljb_: