Class b: All beta proteins [48724] (141 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins) |
Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [50523] (50 PDB entries) |
Domain d1ghae_: 1gha E: [26044] complexed with ipa, so4 |
PDB Entry: 1gha (more details), 2.2 Å
SCOP Domain Sequences for d1ghae_:
Sequence, based on SEQRES records: (download)
>d1ghae_ b.47.1.2 (E:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)} cgvpaiqpvlsglxxivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa vclpsasddfaagttcvttgwgltryxxantpdrlqqaslpllsntnckkywgtkikdam icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq tlaan
>d1ghae_ b.47.1.2 (E:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)} cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd vvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclp sasddfaagttcvttgwgltrytpdrlqqaslpllsntnckkywgtkikdamicagasgv sscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
Timeline for d1ghae_: